PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000546G0840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 127aa    MW: 14087.7 Da    PI: 4.4766
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000546G0840genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.41.1e-2444102260
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
     HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                      Fl+k+y+++ed++++ ++sws+ gnsfvv+d++ fa+ +Lp+ Fkh+nf+SFvRQLn+Y
  PH01000546G0840  44 FLTKTYDLVEDPSTDGVVSWSRAGNSFVVWDPHVFADVLLPRLFKHNNFSSFVRQLNTY 102
                      9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.104.0E-2740105IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.6E-2740124IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467854.62E-2442102IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.9E-154467IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.7E-2144102IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.9E-158294IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.9E-1595107IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MDPVAASVVK EEPLEPPQEG GDVAEAGDAP RPLEGLHEVG PPPFLTKTYD LVEDPSTDGV  60
VSWSRAGNSF VVWDPHVFAD VLLPRLFKHN NFSSFVRQLN TYVSEHPVLS HQSSYGLLRC  120
WYEERQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A6e-19421021878Heat shock factor protein 1
5d5u_B6e-19421022787Heat shock factor protein 1
5d5v_B6e-19421022787Heat shock factor protein 1
5d5v_D6e-19421022787Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613648.12e-50PREDICTED: heat stress transcription factor A-2c
SwissprotQ338B08e-56HFA2C_ORYSJ; Heat stress transcription factor A-2c
TrEMBLA0A0D3HDQ67e-54A0A0D3HDQ6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0BAL97e-54A0A0E0BAL9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IS647e-54A0A0E0IS64_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QZ687e-54A0A0E0QZ68_ORYRU; Uncharacterized protein
TrEMBLA2Z7C37e-54A2Z7C3_ORYSI; Uncharacterized protein
TrEMBLI1QUJ87e-54I1QUJ8_ORYGL; Uncharacterized protein
STRINGLOC_Os10g28340.12e-53(Oryza sativa Japonica Group)
STRINGBGIOSGA031910-PA2e-53(Oryza sativa Indica Group)
STRINGORGLA10G0088100.12e-53(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.11e-38heat shock transcription factor A6B